PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G18480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 338aa    MW: 36763.5 Da    PI: 7.5459
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G18480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.25.7e-113378146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l++ v+ +G+ +W++I ++  + Rt+k+c++rw +
  OPUNC04G18480.1 33 KGPWMAEEDEVLLEHVRTHGPMDWSSIRSKGLLPRTGKSCRLRWVN 78
                     79******************99*****8876677**********87 PP

2Myb_DNA-binding43.38.6e-1489129345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eE+   +++ +q+G++ W++Ia +++ gRt++++k++w 
  OPUNC04G18480.1  89 KFTAEEERVVIELQAQFGNK-WARIATYLQ-GRTDNDVKNFWS 129
                      79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.282880IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-193081IPR009057Homeodomain-like
SuperFamilySSF466895.47E-2631128IPR009057Homeodomain-like
SMARTSM007176.6E-93282IPR001005SANT/Myb domain
CDDcd001673.81E-103580No hitNo description
PfamPF139211.7E-103685No hitNo description
PROSITE profilePS5129420.11281136IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-1882134IPR009057Homeodomain-like
SMARTSM007179.7E-1286134IPR001005SANT/Myb domain
PfamPF002495.3E-1289129IPR001005SANT/Myb domain
CDDcd001672.78E-1089128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MARVPGGVRR RSGRRGGAGG GGGGGGGAEA LRKGPWMAEE DEVLLEHVRT HGPMDWSSIR  60
SKGLLPRTGK SCRLRWVNKL RPNLKSGCKF TAEEERVVIE LQAQFGNKWA RIATYLQGRT  120
DNDVKNFWST RQKRFARLLR GPLPAARSNK QSSGKGKAPS SSSLDSKTAT FHQSSASLDQ  180
ASLEGNSLGW QYREAAPLMG YDQACSGFFA FEGPLPLQLL PPADGEASSS NAAQSAPPPL  240
LFDQPPYPLI NFPGWPERYV DVGHGFVDAG AMDGLAYQEL LPMVQSVPMI MPFFGMECAH  300
DDVKHEPFDD LPPNMFDDAV DQPPPPPPPP SPSRDDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-253113425126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR8552180.0CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634881.10.0PREDICTED: myb-related protein MYBAS2-like, partial
TrEMBLA0A0E0KTJ80.0A0A0E0KTJ8_ORYPU; Uncharacterized protein
STRINGBGIOSGA016880-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g46384.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.13e-63MYB family protein